PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_07552-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 497aa    MW: 54001.1 Da    PI: 5.1579
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_07552-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.5e-39115174261
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      ++k+++cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrk+k+s
  TRIUR3_07552-P1 115 PDKIIPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGSMRNVPVGAGRRKSKNS 174
                      7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-30112172IPR003851Zinc finger, Dof-type
PfamPF027018.4E-32117173IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.761119173IPR003851Zinc finger, Dof-type
PROSITE patternPS013610121157IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MSDQMDSGIK LFGREQHKET KDKGDSEMKV DAPEEKEDGG MKGDELRERK DDEMEVDAPQ  60
AKQNAETASS STLDHKKDDQ AQISNAEEKV ASDPKEENEK KSNDESGQDR VLKKPDKIIP  120
CPRCNSMDTK FCYYNNYNVN QPRHFCKNCQ RYWTAGGSMR NVPVGAGRRK SKNSALHYRQ  180
LLMAPDCLLG SRVDISDTVN PEVLASLPSI PTQSASRNET VLKFGPEVPL CESMVSVLNI  240
EEQNVTNAGS VPRDETREDN SCASTTTSNN GLPANAVPPG QNGAPVYCNG VGPVPQYYLG  300
PPFMYPWSMG WNNLPVMVPG GSMPESASPS ESCSTSSAPW MNSPMMPGSR LPAPPFPYPI  360
VPPALWGCLP SWPAAAWNTP WVGTNGCISP SGSSNSSCSG NGSPTLGKHS RDPNPQKDDK  420
EEKSLWVPKT LRIDDPDEAA KSSIWATLGI KPGDPGVFKP FQFKGESKGQ PADARPARAL  480
QANPAAFSRS QSFQESS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565622.20.0PREDICTED: cyclic dof factor 2-like
TrEMBLM8A0X30.0M8A0X3_TRIUA; Dof zinc finger protein DOF5.2
STRINGMLOC_56598.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-69cycling DOF factor 2